John Leingang @ChoomSlayer
Head Maker of Beer & Slayer of Choom for @9milebrewing. Husband to @maltmarauder. Nerd of All. Walking, talking, snarking Brillo Pad. Minneapolis, MN Joined July 2016-
Tweets391
-
Followers108
-
Following265
-
Likes3K
John Leingang retweeted
There's SO many amazing trading cards of Mark Hamill as Luke Skywalker that Mark's (let's say) enhanced with his own creativity! 🤣 If @MarkHamill replies to this tweet with his favorite card, we'll give one person who retweets this tweet a free box of Star Wars trading cards!
121
2K
3K
0
86
View Details
@AdamLikesBeer @NFLonCBS 🙄 what a bunch of shmucks…
@AdamLikesBeer @BeerBrewin @BellsBrewery @untappd Same @AdamLikesBeer …def. same
This. Right. Here. This thread, and the one it references... important reading.
For the sensitive, this @beerkulture article criticizes white voices coming out to hang Metzger dry. And very rightfully so. Please read and reflect thoughtfully.
@BeerBrewin Done and done. Looks like I’m making a trip to Walmart soon...
The @dessadarling flavor for @IzzysIceCream is off-the-damn-chain good. Full to empty in 4-6 minutes... will definitely purchase again. 🙌🏼
@swankmotron Dang solid choices, all-around. 👍🏻
@TimJohnsonMN Been there, done that as well.
John Leingang retweeted
If you need me, I’ll be @PigAteMyPizza. #DangerDanger @DangerousMan7 @cdangerbrewer
John Leingang retweeted
This from @nytimes is the best cartogram of the US I've seen. How we portray the US shapes our political imagination; given the representation disparities of the Senate and Electoral College, more than ever we need to depict the US in units of population rather than land.
This... 👇🏻👇🏻👇🏻👇🏻👇🏻👇🏻👇🏻
If you don't vote, you're not a rebel. You're *part* of the system. Not voting says: "I'm fine with the state of this country right now." And hear my words: If you're okay with this country right now, you are either woefully uninformed, or monstrously evil. Vote.
John Leingang retweeted
You guys ready for tomorrow? What’s your plan? How many friends are you bringing? Let me know, I’m RT’ing these next two days!!!!
@TimJohnsonMN Agreed... very zen in fact.
Sloughnair @Sloughnairfog
47 Followers 4K Following
Ressheas @Ressheasnwnt
47 Followers 4K Following
Shetoos @Shetoos872334
21 Followers 2K Following The pursuit of truth and knowledge and the struggle for it are one of the highest qualities of human beings
Kristen Thoen @kristenthoen
88 Followers 176 Following![The Kenny G of drinking.
[he/him/his]](https://pbs.twimg.com/profile_images/999482247311863808/eVVyCaDS.jpg)
Dan Murphy @DrinkwithDan
272 Followers 470 Following Drinker of beers,wines and everything else Slinging Malts and ingredients @maltwerks.
Star Frog @MPLXpropaganda
285 Followers 4K Following Antagonist Of Fascism/Brewer of Beers/Mechanic of Bicycles/Tripper of Roads/Searcher of Sounds/Student of Psychedelics/Taker of Naps/Dreamer of Dreams
Dad D @drbbq24
133 Followers 2K Following Husband, GIRL DAD, BBQ, Beer, Bourbon and Burgers (2× Johnson's Burger Battle Champ). And Wine. I geek out on FF. Vikings, Wolves, Twins & Wild 👊
Freehouse Beer @FreehouseBeerMN
476 Followers 1K Following Life Liberty Beer 701 N Washington Ave Minneapolis
T @tphawkeyechief
113 Followers 5K Following
Jeffrey A. Maas @JeffyMonster
128 Followers 969 Following Advocate. Ally. Unbrief. Grayscale. Working on empathy skills. Admirer of craft beer. My pronouns: He/him/his.
scott ivy @ElizabethWekia
134 Followers 997 Following
Minnesota Beer Trail @mnbeertrail
19 Followers 39 Following
Jake Bentz @TripDeezil
394 Followers 2K Following By knowing things that exist, you can know that which does not exist.
Michael @michaelgodell
541 Followers 2K Following Husband, Dad, IIAT (Interested In All Things) sufferer | Post: MichaelO
riess311 @justin_riess
219 Followers 284 Following When the going gets weird the weird turn pro-HST. Wholesale manager & pusher of Fulton Beer in central & Northern Mn area opinions are 100% my own
Garbage Disposal @sixteenth_prez
410 Followers 5K Following
Mashtun and Meow @MashtunandMeow
3K Followers 2K Following Drink beer, work with beer & write about beer. Also chat about fine spirits & good food. Owners of a handsome cat. @Jim_Rangeley & @Laurara31 Views all our own.
BentMATTle @BentMATTle
116 Followers 98 Following Central MN & ND Sales Ambassador and Certified Cicerone® for @bentpaddlebeer. MN outdoor life: hiking, paddling, fishing, and hunting. My tweets are my own.
Actionjacksonmn @actionjacksonmn
19 Followers 210 Following
Koko D @MochaBandit
196 Followers 220 Following I love a lot. Haven’t slept since 2013. (she/her) #slowriotfornewzerokanada #YOUSHOULDANEVACALLEDMEAFATASSKELLYPRICE
Indeed Brewing Co. @indeedbrewing
26K Followers 4K Following Northeast Minneapolis' original taproom and pilot brewery and taproom in Milwaukee. We're not just brewing beer, we're crafting experiences.
Glow-in-the-Dark Phar... @bisonpharmer
67 Followers 665 Following Aspiring brewer, cook, percussionist and bowler, moonlighting as a pharmacist. Views/opinions are my own and do not reflect those of my employer.
Shawn from BGP @ShawnBGP
1K Followers 822 Following @MikeBGP and I are creators of The Beer Genome Project, a podcast and blog focused on discussing and enjoying beer.
✨kitten with a whip... @LeslieSimone_
3K Followers 4K Following 50 and yes that’s an achievement. Personal Stylist, mother of young adults, *adaptogen* lover. Elizabeth Warren forever. IG: LeslieLovesPockets 👗
PDX Craft Beer Fest @pdx_beerfest
1K Followers 4K Following The 2020 Portland Craft Beer Festival. July 3rd-5th. The Fields Park, in the Pearl Distrtict. Over 100 beers, food & more! 🍻 Get tickets below
Happy Gnome @TheHappyGnomeMN
6K Followers 837 Following Voted the best beer bar in MN! We have 89 craft taps, and an amazing food menu brought to you by Chef Scott Brink. Instagram:@thehappygnomemn
Michael @Michael_YoLong
104 Followers 1K Following Professional manufacturer of brewery equipment in China
Elle @_TheElleWord_
190 Followers 340 Following Director of Sales @dunordspirits🤘🏽 Motto: If not Beer, Tequila. 👱🏾♀️🍺💖🥃
IronDoorPub @IronDoorPub
625 Followers 863 Following Neighborhood bar located on the corner of Lyndale & Lake in Uptown Minneapolis.
Heavy Rotation Brewin... @KenMpls
622 Followers 2K Following One of three owners of @heavyrotationbp. Also, the best Twitter follow ever because I won’t blow up your timeline.
Regular Season Steve @moustachesteve
512 Followers 2K Following Good clubhouse guy. Future stay-at-home Twitter dad. Source familiar with the situation. 10 gallon ascots and booze on your shirt.
That Guy with a Beer @The16ozSociety
1K Followers 863 Following Yeah, we have made tshirts. Let's just raise a pint and listen what others have to say.
RJ White @FairStateRJ
183 Followers 196 Following Greater Twin Cities Sales Manager & Member-Owner for @FairStateCoop Union Steward for @fairstate_union
Little Thistle Brewin... @LilThistleBeer
1K Followers 787 Following Brewery & taproom located in Rochester, MN
Stephanie Kushnir @Steph612Brew
85 Followers 301 Following Director of Sales at 612Brew in Minneapolis, Minnesota! Come grab a pint with me!
MN Craft Beer App @mncraftbeerapp
160 Followers 408 Following The ultimate app for brewery fans. Discover and track all of Minnesota's 150+ craft breweries! Download for free today on iOS and Android.
KC Wyckoff @laidoffsick
19 Followers 669 Following i drive the train, literally. former all ND HS hockey west region team (honorable mention) and i know ball, plural. 22 fantasy football champion.
Isabellamiller @Isabell77781949
1 Followers 21 Following
Haskell's Maple Grove... @HaskellsMGBrew
256 Followers 221 Following Family owned and operated since 1934. In-store shopping, curbside pick-up + delivery available. M-Th 9am-8pm, Fri-Sat 9am-9pm, Sun 11am-6pm. (763)-400-7888.
Muddy Pig @themuddypig
3K Followers 248 Following St. Paul's original craft beer pub! 48 rotating taps, lunch, dinner, weekend brunch, great whiskey and wine. Instagram: @muddypigstpaul
Matthew Hauck @MatthewHauck
175 Followers 247 Following
Not that Tyler @teehitch
290 Followers 656 Following Marketing Manager, Graphic Designer, and Beer Blogger for Top Ten Liquors. Tweets be my own if they be here.
bekahsoka✨ @bekahsoka
12K Followers 265 Following A dorky cosplayer spending all my time on Batuu🩷 She/Her ⬧ Streamer ⬧︎ Cosplayer✨
Holly Amos @hollyamos22
7K Followers 701 Following Consulting professional Trekspert (currently w/ @Roddenberry; formerly w/ @CBS and @StarTrek_CCG) and organizer guru. She/her.
Cohesion Brewing Comp... @cohesionbeer
159 Followers 45 Following Czech Lager focused brewery in the Clayton neighborhood of Denver.
Evil Ink Comics @EvilInkComics
14K Followers 518 Following Home of #TheAmoryWars, #KillAudio, #KeyOfZ, #Translucid and #KidCrazyAndTheKilowattKing. #MBBM. The Amory Wars NWFT #12 in shops now! @Coheed @thepfiofficial
Scott Lynch @scottlynch78
58K Followers 461 Following New York Times Best Selling author of the Gentleman Bastard sequence. Volunteer firefighter, 2005-2016. He/him. https://t.co/jgJyfmBqVQ
Swear Trek @swear_trek
123K Followers 589 Following GIFs by @aaronreynolds & tweets by @kris__myers. Captions by @NicRobes, @ninjaburger, @noemptyline, & @joesondow. Loves colourful metaphors. ON HIATUS
GWF Podcast w/Corinne... @GuysWeFcked
33K Followers 672 Following The podcast that created an entire genre. Since 2013. New episodes every Friday.
MSP Airport @mspairport
40K Followers 2K Following MSPAirport is ranked #1 in customer satisfaction for mega airports by @JDPower! For J.D. Power 2024 award information, visit https://t.co/bZLlJfs7sR
Mashtun and Meow @MashtunandMeow
3K Followers 2K Following Drink beer, work with beer & write about beer. Also chat about fine spirits & good food. Owners of a handsome cat. @Jim_Rangeley & @Laurara31 Views all our own.
Venn Brewing @vennbrewing
2K Followers 270 Following Dog-friendly Taproom & Coffee Shop in S Mpls. Hours: MON 4-10pm, TUE-THU 8am-10pm, FRI & SAT 8am-11pm, SUN 8am-9pm. Leashed puppers welcome inside and out.
Harrison Smith @harrismith22
129K Followers 468 Following
Jones @xxcaseyjones
1K Followers 537 Following Life's more fun when you're smiling. Bagel Queen. Thunderstorm lover. She/her
Taika Waititi @TaikaWaititi
1.4M Followers 709 Following Bespoke tweets hand-crafted from locally sourced vintage dickhead.
Paul Stamets @PaulStamets
186K Followers 87 Following Mycologist, Author, Inventor, Teacher, Earthling
Today Years Old @todayyearsold
1.1M Followers 107 Following Your source for the latest trends, discoveries, and most shocking truths & little-known facts about the world. 🚀 DM us your findings!
The Oatmeal @Oatmeal
525K Followers 619 Following Cartoonist and Creator of the Exploding Kittens Netflix series
The G.L.O.A.T. @LakeSuperior
199K Followers 297 Following I am the greatest lake of all time. G.L.O.A.T. (she/her) #BigBeautifulWater
The CryptoNaturalist ... @CryptoNature
32K Followers 720 Following The CryptoNaturalist (podcast by Jarod K. Anderson) New Novel: Strange Animals (Cozy/Creepy/Cryptid Fantasy)
Nihilist Arby's @nihilist_arbys
318K Followers 0 Following Officially, I have nothing to do with arby's. Unofficially, everything is nothing. Eat Arby's
Koko D @MochaBandit
196 Followers 220 Following I love a lot. Haven’t slept since 2013. (she/her) #slowriotfornewzerokanada #YOUSHOULDANEVACALLEDMEAFATASSKELLYPRICE
Merkin Vineyards @merkinvineyards
9K Followers 126 Following Merkin Vineyards Hilltop Trattoria, Merkin Kebab and Gelato Wagon. #arizonawine
Caduceus Cellars @caduceuscellars
59K Followers 183 Following MJ Keenan, Winemaker/Owner. Available in the US, Canada, Europe & Australia. Caduceus Cellars, Merkin Vineyards. #arizonawine
Maynard J Keenan @mjkeenan
296K Followers 184 Following Defector From the Petty War, World Class Multi-tasker, Story Teller, Winemaker, Curmudgeon, Armed Snowflake.
Tom Shellhammer @TomShellhammer
673 Followers 141 Following Nor'Wester Endowed Professor of Brewing Science at Oregon State University. Brewing scientist, observer of beer culture, beer geek, swimmer, parent.
Claudio Sanchez @claudioPsanchez
57K Followers 219 Following Coheed and Cambria, The Prize Fighter Inferno, Funny Book Creator... 💋
Coheed and Cambria @Coheed
104K Followers 480 Following We are a band from New York. The Father of Make Believe deluxe is here!
TNG Season 8 @TNG_S8
62K Followers 41 Following Plots from the unaired 8th season of Star Trek: The Next Generation. -- Captain's log: @mikemcmahanTM
Worf Email @WorfEmail
35K Followers 1 Following No longer permitted to post here. (Written and automated by @JoeSondow) Mastodon: @[email protected] Bluesky: @WorfEmail.bsky.social
Shannon Blowtorch @msblowtorch
2K Followers 2K Following For bookings contact: [email protected] https://t.co/VzVY9nWYqc https://t.co/eIx0WANQkG https://t.co/5bPr1Voyfl
sophia urista @sophiaurista
19K Followers 678 Following Global Vex Symbol. My latest single 'PRESSURE' is out. See me in John Wick 1, Matrix Resurrections, The Voice #11, Brass Against
Shawn from BGP @ShawnBGP
1K Followers 822 Following @MikeBGP and I are creators of The Beer Genome Project, a podcast and blog focused on discussing and enjoying beer.
Alexandria Ocasio-Cor... @AOC
12.7M Followers 4K Following US Congresswoman, NY-14. In a modern, moral, and wealthy society, no American should be too poor to live. People-Funded, takes no lobbyist💰. Personal account.
Mr. Spock 🖖 (Comme... @SpockResists
103K Followers 40K Following Science Officer|Commentary Account 🖖Logic over Lunacy. No DM’s| From Vulcan| Lives in London
Eastside Food Co-op @EastsideCoop
2K Followers 685 Following Your community owned grocery store in the heart of Northeast Minneapolis. Eastside Food Co-op is here for good!
Herbivorous Butcher @TheHerbivorousB
9K Followers 2K Following 1st #VeganButcher Shop in the US. We ship nationwide! Founders of @herbivorousacre & Herbie Butcher's Fried Chicken.
Jess Phoenix, Lava Co... @jessphoenix2018
61K Followers 4K Following https://t.co/lVOR7sdVDh or volcano.jess on Insta. Science Ambassador @UCSUSA, volcanologist, #MsAdventure author, founder @BlueprintEarth, horse trainer. 🏳️🌈
Live Oak Brewing Co. @LiveOakBrewing
16K Followers 463 Following 25 Years of Fresh Cold Beers | Quality Lagers and Ales | Made in the Shade
Palmer’s Bar @MplsPalmers
675 Followers 5 Following
Dara Moskowitz Grumda... @DearDara
17K Followers 2K Following Novelist, radicalized mom, award winning features & fiction; on all other platforms same name! Weekly quirky/deep email, sign up: https://t.co/AO85z1mIwK
Michael Pollan @michaelpollan
572K Followers 795 Following Author of A World Appears; This is Your Mind on Plants; How to Change Your Mind; Cooked; In Defense of Food; The Omnivore’s Dilemma, and The Botany of Desire.You might like
Ryan Tuenge
@lodgefather
1K Followers
TheCak
@TheCakFF
333 Followers
A One Pint Stand
@AOnePintStand
161 Followers